new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 1
LigandBDBM50281776
Substrate/Competitorn/a
Meas. Tech.ChEBML_144142
IC50 26000±n/a nM
Citation Beck-Sickinger AGHoffmann EGaida WGrouzmann EDürr HJung G Novel Y2-selective, reduced-size agonists of neuropeptide Y Bioorg Med Chem Lett 3:937-942 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Neuropeptide Y receptor type 1
Name:Neuropeptide Y receptor type 1
Synonyms:NPY-Y1 | NPY1-R | neuropeptide Y receptor Y1
Type:Enzyme Catalytic Domain
Mol. Mass.:44399.07
Organism:Homo sapiens (Human)
Description:NPY-Y1 NPY1R HUMAN::P25929
Residue:384
Sequence:
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA
LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ
CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMT
DEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKR
RNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNL
LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVS
KTSLKQASPVAFKKINNNDDNEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281776
n/a
NameBDBM50281776
Synonyms:Ac-RHYIN-(Cha)-(Cha)-TRQRY | CHEMBL268351
TypeSmall organic molecule
Emp. Form.C79H123N25O19
Mol. Mass.1726.978
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1cnc[nH]1)NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C1CCCCC1)C(=O)N[C@@H](C1CCCCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: