new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukotriene B4 receptor
LigandBDBM50281876
Substrate/Competitorn/a
Meas. Tech.ChEMBL_98504
Ki 16±n/a nM
Citation Sofia MJFloreancig PJackson WTMarder PSaussy DLSilbaugh SACockerham SLFroelich LLRoman CRStengel PWFleisch JH Acid unit modifications of 1,2,4,5-substituted hydroxyacetophenones and the effect on in vitro and in vivo LTB4 receptor antagonism Bioorg Med Chem Lett 3:1147-1152 (1993)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukotriene B4 receptor
Name:Leukotriene B4 receptor
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:Homo sapiens (Human)
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50281876
n/a
NameBDBM50281876
Synonyms:2-{3-[3-(4-Acetyl-2-ethyl-5-hydroxy-phenoxy)-propoxy]-2-propyl-phenoxy}-butyric acid | CHEMBL15295
TypeSmall organic molecule
Emp. Form.C26H34O7
Mol. Mass.458.544
SMILESCCCc1c(OCCCOc2cc(O)c(cc2CC)C(C)=O)cccc1OC(CC)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: