| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50282003 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_162611 |
|---|
| IC50 | 30±n/a nM |
|---|
| Citation |  Holmes, DS; Bethell, RC; Hann, MM; Kitchin, J; Starkey, ID; Storer, R The design and synthesis of novel hydroxyproline inhibitors of HIV-1 proteinase Bioorg Med Chem Lett3:1485-1491 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50282003 |
|---|
| n/a |
|---|
| Name | BDBM50282003 |
|---|
| Synonyms: | (2R,4S)-2-((R)-Benzylcarbamoyl-phenylacetylamino-methyl)-5,5-dimethyl-thiazolidine-4-carboxylic acid ((S)-5-tert-butylcarbamoyl-3-hydroxy-1-isobutyl-pyrrolidin-3-ylmethyl)-amide | CHEMBL289409 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H54N6O5S |
|---|
| Mol. Mass. | 694.927 |
|---|
| SMILES | CC(C)CN1CC(O)(CNC(=O)[C@@H]2N[C@H](SC2(C)C)[C@H](NC(=O)Cc2ccccc2)C(=O)NCc2ccccc2)C[C@H]1C(=O)NC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
