new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLanosterol synthase
LigandBDBM50282635
Substrate/Competitorn/a
Meas. Tech.ChEMBL_89
Ki 110±n/a nM
Citation Marquart ALSchatzman GLPeet NPMoore WRHuber EWGallion SLAngelastro MR Inhibition of oxidosqualene cyclase by substituted quinolizidines Bioorg Med Chem Lett 4:1317-1318 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Lanosterol synthase
Name:Lanosterol synthase
Synonyms:2,3-epoxysqualene--lanosterol cyclase | OSC | Oxidosqualene--lanosterol cyclase
Type:PROTEIN
Mol. Mass.:83309.32
Organism:Homo sapiens (Human)
Description:ChEMBL_84
Residue:732
Sequence:
MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDT
KNYFKDLPKAHTAFEGALNGMTFYVGLQAEDGHWTGDYGGPLFLLPGLLITCHVARIPLP
AGYREEIVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVSLRILGVGPDDPDLVRARNIL
HKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPDWAPAHPSTLWCHCRQVYLPM
SYCYAVRLSAAEDPLVQSLRQELYVEDFASIDWLAQRNNVAPDELYTPHSWLLRVVYALL
NLYEHHHSAHLRQRAVQKLYEHIVADDRFTKSISIGPISKTINMLVRWYVDGPASTAFQE
HVSRIPDYLWMGLDGMKMQGTNGSQIWDTAFAIQALLEAGGHHRPEFSSCLQKAHEFLRL
SQVPDNPPDYQKYYRQMRKGGFSFSTLDCGWIVSDCTAEALKAVLLLQEKCPHVTEHIPR
ERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQA
LKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMG
QTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYLQSAQSQIHNTCWAMMGLM
AVRHPDIEAQERGVRCLLEKQLPNGDWPQENIAGVFNKSCAISYTSYRNIFPIWALGRFS
QLYPERALAGHP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282635
n/a
NameBDBM50282635
Synonyms:(1R,7R,9aS)-7-Decyl-octahydro-quinolizin-1-ol | CHEMBL278521
TypeSmall organic molecule
Emp. Form.C19H37NO
Mol. Mass.295.5032
SMILESCCCCCCCCCC[C@@H]1CC[C@H]2[C@H](O)CCCN2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: