Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50282663 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159322 |
---|
IC50 | 3.4±n/a nM |
---|
Citation | Kaldor, SW; Hammond, M; Dressman, BA; Fritz, JE; Crowell, TA; Hermann, RA New dipeptide isosteres useful for the inhibition of HIV-1 protease Bioorg Med Chem Lett4:1385-1390 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50282663 |
---|
n/a |
---|
Name | BDBM50282663 |
Synonyms: | (S)-N*1*-[(1S,2R)-1-Benzyl-3-(2-tert-butylcarbamoyl-4-methyl-phenyl)-2-hydroxy-propyl]-2-[(quinoline-2-carbonyl)-amino]-succinamide | CHEMBL27120 | LY-289598 |
Type | Small organic molecule |
Emp. Form. | C36H41N5O5 |
Mol. Mass. | 623.7412 |
SMILES | Cc1ccc(C[C@@H](O)[C@H](Cc2ccccc2)NC(=O)[C@H](CC(N)=O)NC(=O)c2ccc3ccccc3n2)c(c1)C(=O)NC(C)(C)C |
Structure |
|