new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-1
LigandBDBM50282981
Substrate/Competitorn/a
Meas. Tech.ChEBML_91007
Ki 4.7±n/a nM
Citation Mjalli AMChapman KTMacCoss MThornberry NAPeterson EP Activated ketones as potent reversible inhibitors of interleukin-Iβ converting enzyme Bioorg Med Chem Lett 4:1965-1968 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Caspase-1
Name:Caspase
Synonyms:Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:Enzyme
Mol. Mass.:45154.13
Organism:Homo sapiens (Human)
Description:P29466
Residue:404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282981
n/a
NameBDBM50282981
Synonyms:3-{(S)-2-[(S)-3-Methyl-2-(3-phenyl-propionylamino)-butyrylamino]-propionylamino}-4-oxo-5-phenethylamino-pentanoic acid | CHEMBL58012
TypeSmall organic molecule
Emp. Form.C30H40N4O6
Mol. Mass.552.6618
SMILESCC(C)[C@H](NC(=O)CCc1ccccc1)C(=O)N[C@@H](C)C(=O)NC(CC(O)=O)C(=O)CNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: