new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-1
LigandBDBM50283349
Substrate/Competitorn/a
Meas. Tech.ChEBML_91005
Ki 2100±n/a nM
Citation Mullican MDLauffer DJGillespie RJMatharu SSKay DPorritt GMEvans PLGolec JMMurcko MALuong YPRaybuck SALivingston DJ The synthesis and evaluation of peptidyl aspartyl aldehydes as inhibitors of ice. Bioorg Med Chem Lett 4:2359-2364 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Caspase-1
Name:Caspase
Synonyms:Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:Enzyme
Mol. Mass.:45154.13
Organism:Homo sapiens (Human)
Description:P29466
Residue:404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283349
n/a
NameBDBM50283349
Synonyms:(S)-3-{(S)-2-[(S)-2-Acetylamino-3-(4-hydroxy-phenyl)-propionylamino]-propionylamino}-4-oxo-butyric acid | CHEMBL78028
TypeSmall organic molecule
Emp. Form.C18H23N3O7
Mol. Mass.393.3911
SMILESC[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(C)=O)C(=O)N[C@@H](CC(O)=O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: