| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor B |
|---|
| Ligand | BDBM50044355 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_34810 (CHEMBL648954) |
|---|
| IC50 | 5±n/a nM |
|---|
| Citation |  Huang, HC; Chamberlain, TS; Olins, GM; Corpus, VM; Chen, ST; McMahon, EG; Palomo, MA; Blaine, EH; Manning, RE Discovery of nonpeptide potent conformationally restricted angiotensin II receptor antagonists Bioorg Med Chem Lett4:2591-2596 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-1 angiotensin II receptor B |
|---|
| Name: | Type-1 angiotensin II receptor B |
|---|
| Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40929.44 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT1B 0 RAT::P29089 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
|---|
| BDBM50044355 |
|---|
| n/a |
|---|
| Name | BDBM50044355 |
|---|
| Synonyms: | 2,5-Dibutyl-4-[2'-(1H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-2,4-dihydro-[1,2,4]triazol-3-one(SC-15316) | 2,5-Dibutyl-4-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-2,4-dihydro-[1,2,4]triazol-3-one | 2,5-Dibutyl-4-[2'-(2H-tetrazol-5-yl)-biphenyl-4-ylmethyl]-[1,2,4]triazolidin-3-one | CHEMBL87778 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H29N7O |
|---|
| Mol. Mass. | 431.5334 |
|---|
| SMILES | CCCCc1nn(CCCC)c(=O)n1Cc1ccc(cc1)-c1ccccc1-c1nnn[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
