new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50283731
Substrate/Competitorn/a
Meas. Tech.ChEBML_79815
IC50 0.110000±n/a nM
Citation Dorsey BDMcDaniel SLLevin RBVacca JPDarke PLZuga JAEmini EASchleif WALin JHChen IWHolloway MKAnderson PSHuff JR Synthesis and evaluation of pyridyl analogs of L-735,524: Potent HIV-1 protease inhibitors Bioorg Med Chem Lett 4:2769-2774 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283731
n/a
NameBDBM50283731
Synonyms:(S)-4-(4-Bromo-thiophen-2-ylmethyl)-1-[(2S,4R)-2-hydroxy-4-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-5-pyridin-4-yl-pentyl]-piperazine-2-carboxylic acid tert-butylamide | CHEMBL318777
TypeSmall organic molecule
Emp. Form.C34H44BrN5O4S
Mol. Mass.698.713
SMILESCC(C)(C)NC(=O)[C@@H]1CN(Cc2cc(Br)cs2)CCN1C[C@@H](O)C[C@@H](Cc1ccncc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: