new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II receptor
LigandBDBM50283766
Substrate/Competitorn/a
Meas. Tech.ChEBML_36626
IC50 2.4±n/a nM
Citation Chang LLAshton WTFlanagan KLRivero RAChen TBO'Malley SSZingaro GJKivlighn SDSiegl PKLotti VJChang RSGreenlee WJ Potent triazolinone-based angiotensin II receptor antagonists with equivalent affinity for both the AT1 and AT2 subtypes Bioorg Med Chem Lett 4:2787-2792 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II receptor
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Angiotensin II, central | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41201.61
Organism:Homo sapiens (Human)
Description:Angiotensin II, central 0 0::P50052
Residue:363
Sequence:
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283766
n/a
NameBDBM50283766
Synonyms:CHEMBL313868 | N-(3-{3-Butyl-4-[3-fluoro-2'-(2-fluoro-benzoylsulfamoyl)-5'-propyl-biphenyl-4-ylmethyl]-5-oxo-4,5-dihydro-[1,2,4]triazol-1-yl}-4-chloro-phenyl)-acetamide
TypeSmall organic molecule
Emp. Form.C37H36ClF2N5O5S
Mol. Mass.736.227
SMILESCCCCc1nn(-c2cc(NC(C)=O)ccc2Cl)c(=O)n1Cc1ccc(cc1F)-c1cc(CCC)ccc1S(=O)(=O)NC(=O)c1ccccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: