new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM50283767
Substrate/Competitorn/a
Meas. Tech.ChEBML_36766
IC50 4.9±n/a nM
Citation Chang LLAshton WTFlanagan KLRivero RAChen TBO'Malley SSZingaro GJKivlighn SDSiegl PKLotti VJChang RSGreenlee WJ Potent triazolinone-based angiotensin II receptor antagonists with equivalent affinity for both the AT1 and AT2 subtypes Bioorg Med Chem Lett 4:2787-2792 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283767
n/a
NameBDBM50283767
Synonyms:CHEMBL94793 | Pentanoic acid (3-{3-butyl-4-[2'-(2-chloro-benzoylsulfamoyl)-5'-ethyl-biphenyl-4-ylmethyl]-5-oxo-4,5-dihydro-[1,2,4]triazol-1-yl}-4-chloro-phenyl)-amide
TypeSmall organic molecule
Emp. Form.C39H41Cl2N5O5S
Mol. Mass.762.744
SMILESCCCCC(=O)Nc1ccc(Cl)c(c1)-n1nc(CCCC)n(Cc2ccc(cc2)-c2cc(CC)ccc2S(=O)(=O)NC(=O)c2ccccc2Cl)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: