| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-2 angiotensin II receptor |
|---|
| Ligand | BDBM50035451 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_36766 |
|---|
| IC50 | 17±n/a nM |
|---|
| Citation |  Chang, LL; Ashton, WT; Flanagan, KL; Rivero, RA; Chen, TB; O'Malley, SS; Zingaro, GJ; Kivlighn, SD; Siegl, PK; Lotti, VJ; Chang, RS; Greenlee, WJ Potent triazolinone-based angiotensin II receptor antagonists with equivalent affinity for both the AT1 and AT2 subtypes Bioorg Med Chem Lett4:2787-2792 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-2 angiotensin II receptor |
|---|
| Name: | Type-2 angiotensin II receptor |
|---|
| Synonyms: | AGTR2_RAT | AT2 | Agtr2 | Angiotensin II AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 41346.62 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT2 0 0::P35351 |
|---|
| Residue: | 363 |
|---|
| Sequence: | MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
|
|
|
|---|
| BDBM50035451 |
|---|
| n/a |
|---|
| Name | BDBM50035451 |
|---|
| Synonyms: | 2-{4-[3-butyl-5-oxo-1-(2-trifluoromethylphenyl)-4,5-dihydro-1H-1,2,4-triazol-4-ylmethyl]phenyl}-1-(N-t-butoxycarbonyl)benzenesulfonamide | 4'-[3-Butyl-5-oxo-1-(2-trifluoromet hyl-phenyl)-15-dihydro-[124]tria zol-4-ylmethyl]-biphenyl-2-sulfonic acid t-butyloxycarbonylamide (L-162234) | 4'-[3-Butyl-5-oxo-1-(2-trifluoromethyl-phenyl)-1,5-dihydro-[1,2,4]triazol-4-ylmethyl]-biphenyl-2-sulfonic acid (2-tert-butoxycarbonyl)amide | 4'-[3-Butyl-5-oxo-1-(2-trifluoromethyl-phenyl)-1,5-dihydro-[1,2,4]triazol-4-ylmethyl]-biphenyl-2-sulfonic acid amide-N-carbonyoxylterbutyl | 5-n-Butyl-4-[[2'-[N-(tert-butoxycarbonyl)sulfamoyl]biphenyl-4yl]methyl]-2-[2-trifluoromethyl-phenyl]-2,4-dihydro-3H-1,2,4-triazol-3-one | CHEMBL292150 | L-162234 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H33F3N4O5S |
|---|
| Mol. Mass. | 630.678 |
|---|
| SMILES | CCCCc1nn(-c2ccccc2C(F)(F)F)c(=O)n1Cc1ccc(cc1)-c1ccccc1S(=O)(=O)NC(=O)OC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
