| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Leukotriene B4 receptor 1 |
|---|
| Ligand | BDBM50284123 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_99648 |
|---|
| IC50 | 0.850000±n/a nM |
|---|
| Citation |  Djuric', SW; Docter, SH; Yu, SS; Tsai, BS; Anglin, CP; Gaginella, TS; Kachur, JF; Keith, RH; Maziasz, TJ; Villani-Price, D; Rao, TS; Walsh, RE; Widomski, DL; Fretland, DJ Synthesis and pharmacological activity of SC-53228, a leukotriene B4 receptor antagonist with high intrinsic potency and selectivity Bioorg Med Chem Lett4:811-816 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Leukotriene B4 receptor 1 |
|---|
| Name: | Leukotriene B4 receptor 1 |
|---|
| Synonyms: | BLT | BLT1 | BLTR | CMKRL1 | Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | GPR16 | LT4R1_HUMAN | LTB4-R 1 | LTB4R | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2RY7 | P2Y purinoceptor 7 | P2Y7 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 37582.68 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q15722 |
|---|
| Residue: | 352 |
|---|
| Sequence: | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
|
|
|
|---|
| BDBM50284123 |
|---|
| n/a |
|---|
| Name | BDBM50284123 |
|---|
| Synonyms: | 7-[3-(3-Methoxy-4-methylcarbamoyl-2-propyl-phenoxy)-propoxy]-8-propyl-chroman-2-carboxylic acid | CHEMBL167804 | SC-50073 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H37NO7 |
|---|
| Mol. Mass. | 499.5959 |
|---|
| SMILES | CCCc1c(OCCCOc2ccc3CCC(Oc3c2CCC)C(O)=O)ccc(C(=O)NC)c1OC |
|---|
| Structure | 
|
|---|
Search and Browse
