new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarnitine palmitoyltransferase 2
LigandBDBM50284164
Substrate/Competitorn/a
Meas. Tech.ChEBML_46179
IC50 235000±n/a nM
Citation Kumaravel GBháird NNFronczek FRRamsay RRAshendel CLGandour RD Evaluation of (2S,4S)/(2R,4R) and (2S,4R)/(2<... Bioorg Med Chem Lett 4:883-886 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Carnitine palmitoyltransferase 2
Name:Carnitine palmitoyltransferase 2
Synonyms:CPT II | Carnitine O-palmitoyltransferase 2, mitochondrial | Carnitine palmitoyltransferase II
Type:PROTEIN
Mol. Mass.:73789.25
Organism:Homo sapiens (Human)
Description:ChEMBL_887455
Residue:658
Sequence:
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT
DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284164
n/a
NameBDBM50284164
Synonyms:(S)-2-Hexadecyl-2-hydroxy-4,4-dimethyl-morpholin-4-ium; bromide | CHEMBL169705
TypeSmall organic molecule
Emp. Form.C22H46NO2
Mol. Mass.356.6056
SMILESCCCCCCCCCCCCCCCC[C@@]1(O)C[N+](C)(C)CCO1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: