Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50284183 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_66281 |
---|
EC50 | 34±n/a nM |
---|
Citation | Goulet, MT; Hodkey, DW; Staruch, MJ; Dumont, FJ; Cryan, JG; Parsons, WH; Wyvratt, MJ Alkyl ether analogs of the FK-506 related, immunosuppressive macrolide L-683,590 (ascomycin) Bioorg Med Chem Lett4:921-926 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50284183 |
---|
n/a |
---|
Name | BDBM50284183 |
Synonyms: | C32-O-cinnamyl ether analogue of L-683590 | CHEMBL406510 |
Type | Small organic molecule |
Emp. Form. | C52H76N2O14 |
Mol. Mass. | 953.1648 |
SMILES | CC[C@@H]1\C=C(C)\C[C@H](C)C[C@H](OC)[C@H]2O[C@](O)([C@H](C)C[C@@H]2OC)C(=O)C(=O)N2CCCC[C@H]2C(=O)O[C@@H]([C@H](C)[C@@H](O)CC1=O)C(\C)=C\[C@@H]1CC[C@@H](OC\C=C\c2cccc(c2)[N+]([O-])=O)[C@@H](C1)OC |c:3| |
Structure |
|