BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase BLK
LigandBDBM3033
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210902
IC50>10000±n/a nM
Citation Kleinschroth JHartenstein JRudolph CSchächtele C Novel indolocarbazole protein kinase c inhibitors with improved biochemical and physicochemical properties Bioorg Med Chem Lett 5:55-60 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase BLK
Name:Tyrosine-protein kinase BLK
Synonyms:B lymphocyte kinase | p55-Blk
Type:PROTEIN
Mol. Mass.:56676.10
Organism:Mus musculus
Description:ChEMBL_810654
Residue:499
Sequence:
MGLLSSKRQVSEKGKGWSPVKIRTQDKAPPPLPPLVVFNHLAPPSPNQDPDEEERFVVAL
FDYAAVNDRDLQVLKGEKLQVLRSTGDWWLARSLVTGREGYVPSNFVAPVETLEVEKWFF
RTISRKDAERQLLAPMNKAGSFLIRESESNKGAFSLSVKDITTQGEVVKHYKIRSLDNGG
YYISPRITFPTLQALVQHYSKKGDGLCQKLTLPCVNLAPKNLWAQDEWEIPRQSLKLVRK
LGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKTLQHERLVRLYAVVTRE
PIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQVAEGMAYIERMNSIHRDLRAANI
LVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGVLLM
EIVTYGRVPYPGMSNPEVIRSLEHGYRMPCPETCPPELYNDIITECWRGRPEERPTFEFL
QSVLEDFYTATEGQYELQP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3033
n/a
NameBDBM3033
Synonyms:3-{23-methyl-14-oxo-3,13,23-triazahexacyclo[14.7.0.0^{2,10}.0^{4,9}.0^{11,15}.0^{17,22}]tricosa-1(16),2(10),4(9),5,7,11(15),17,19,21-nonaen-3-yl}propanenitrile | CHEMBL302449 | Go 6976 | Indolocarbazole deriv.
TypeSmall organic molecule
Emp. Form.C24H18N4O
Mol. Mass.378.4259
SMILESCn1c2ccccc2c2c3C(=O)NCc3c3c4ccccc4n(CCC#N)c3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: