new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM50012434
Substrate/Competitorn/a
Meas. Tech.ChEBML_99992
Ki 8000±n/a nM
Citation Andrews EGAntognoli GWBreslow RCarta MPCarty TJChambers RJCheng JBCohan VLCollins JLDamon DBDelehunt JEggler JFEskra JDFreiert KWHada WAMarfat AMasamune HMelvin LSMularski CJNaclerio BA Synthesis and pharmacological profile of two novel heterocyclic chromanols, CP-80,798 and CP-85,958, as potent LTD4 receptor antagonists Bioorg Med Chem Lett 5:1365-1370 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50012434
n/a
NameBDBM50012434
Synonyms:(REV-5,901)1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol | 1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol | 1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol (RG 5901) | 1-[3-(Quinolin-2-ylmethoxy)-phenyl]-hexan-1-ol(REV-5901) | CHEMBL8747 | REV-5901 | REV-901
TypeSmall organic molecule
Emp. Form.C22H25NO2
Mol. Mass.335.4394
SMILESCCCCCC(O)c1cccc(OCc2ccc3ccccc3n2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: