new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCysteinyl leukotriene receptor 1
LigandBDBM50284680
Substrate/Competitorn/a
Meas. Tech.ChEBML_99989
Ki 1640±n/a nM
Citation Masamune HEggler JFMarfat AMelvin LSRusek FWTickner JECheng JBShirley JT LTD4 Receptor binding activity of novel pyridine chromanols: qualitative correlation with pKa Bioorg Med Chem Lett 5:1371-1376 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Cysteinyl leukotriene receptor 1
Name:Cysteinyl leukotriene receptor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:39007.58
Organism:GUINEA PIG
Description:Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284680
n/a
NameBDBM50284680
Synonyms:(3S,4S)-3-Pyridin-3-ylmethyl-6-(quinolin-2-ylmethoxy)-chroman-4-ol | 3-Pyridin-3-ylmethyl-6-(quinolin-2-ylmethoxy)-chroman-4-ol | CHEMBL282524 | CP-80798
TypeSmall organic molecule
Emp. Form.C25H22N2O3
Mol. Mass.398.4538
SMILESO[C@H]1[C@@H](Cc2cccnc2)COc2ccc(OCc3ccc4ccccc4n3)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: