| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50284916 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79465 |
|---|
| Ki | 8±n/a nM |
|---|
| Citation |  Randad, RS; Lubkowska, L; Bhat, TN; Munshi, S; Gulnik, SV; Yu, B; Erickson, JW Symmetry-based HIV Protease inhibitors: rational design of 2-methylbenzamides as novel P2/P2′ ligands Bioorg Med Chem Lett5:1707-1712 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50284916 |
|---|
| n/a |
|---|
| Name | BDBM50284916 |
|---|
| Synonyms: | 1N-[1-benzyl-2,3-dihydroxy-4-(2-methylphenylcarboxamido)-5-phenyl-(1S,2R,3S,4S)-pentyl]-2-methylbenzamide | CHEMBL47551 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H36N2O4 |
|---|
| Mol. Mass. | 536.6606 |
|---|
| SMILES | Cc1ccccc1C(=O)N[C@@H](Cc1ccccc1)[C@@H](O)[C@@H](O)[C@H](Cc1ccccc1)NC(=O)c1ccccc1C |
|---|
| Structure | 
|
|---|
Search and Browse
