| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50284984 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79474 |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Park, C; Koh, JS; Son, YC; Choi, Hi; Lee, CS; Choy, N; Moon, KY; Jung, WH; Kim, SC; Yoon, H Rational design of irreversible, pseudo-C2-symmetric hiv-1 protease inhibitors Bioorg Med Chem Lett5:1843-1848 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50284984 |
|---|
| n/a |
|---|
| Name | BDBM50284984 |
|---|
| Synonyms: | (R)-3-Methyl-N-[(S)-1-((2R,3S)-3-{[(S)-3-methyl-2-(3-methyl-3-pyridin-2-ylmethyl-ureido)-butyrylamino]-methyl}-oxiranyl)-2-phenyl-ethyl]-2-(3-methyl-3-pyridin-2-ylmethyl-ureido)-butyramide | CHEMBL53328 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H50N8O5 |
|---|
| Mol. Mass. | 686.8435 |
|---|
| SMILES | CC(C)[C@H](NC(=O)N(C)Cc1ccccn1)C(=O)NC[C@@H]1O[C@@H]1[C@H](Cc1ccccc1)NC(=O)[C@H](NC(=O)N(C)Cc1ccccn1)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
