new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50284990
Substrate/Competitorn/a
Meas. Tech.ChEBML_79474
Ki 300±n/a nM
Citation Park CKoh JSSon YCChoi HiLee CSChoy NMoon KYJung WHKim SCYoon H Rational design of irreversible, pseudo-C2-symmetric hiv-1 protease inhibitors Bioorg Med Chem Lett 5:1843-1848 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50284990
n/a
NameBDBM50284990
Synonyms:CHEMBL54394 | {(R)-2-Methyl-1-[(S)-1-((2R,3S)-3-{[(S)-3-methyl-2-(pyridin-4-ylmethoxycarbonylamino)-butyrylamino]-methyl}-oxiranyl)-2-phenyl-ethylcarbamoyl]-propyl}-carbamic acid pyridin-4-ylmethyl ester
TypeSmall organic molecule
Emp. Form.C35H44N6O7
Mol. Mass.660.7599
SMILESCC(C)[C@H](NC(=O)OCc1ccncc1)C(=O)NC[C@@H]1O[C@@H]1[C@H](Cc1ccccc1)NC(=O)[C@H](NC(=O)OCc1ccncc1)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: