new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 reverse transcriptase
LigandBDBM1437
Substrate/Competitorn/a
Meas. Tech.ChEBML_80573
IC50 5200±n/a nM
Citation Genin MJChidester CGRohrer DCRomero DL Design and synthesis of a conformationally constrained analog of the bis(heteroaryl)piperazine (BHAP) HIV-1 reverse transcriptase inhibitor atevirdine Bioorg Med Chem Lett 5:1875-1880 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 reverse transcriptase
Name:Human immunodeficiency virus type 1 reverse transcriptase
Synonyms:Reverse transcriptase/RNaseH
Type:PROTEIN
Mol. Mass.:65229.15
Organism:Human immunodeficiency virus 1
Description:ChEMBL_1473730
Residue:566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM1437
n/a
NameBDBM1437
Synonyms:5-methoxyindole-2-carboxylic acid [N -[3-(aminoethyl)pyridin-2-yl]piperazide] | BHAP deriv. | CHEMBL280527 | CHEMBL7264 | N-ethyl-2-{4-[(5-methoxy-1H-indol-2-yl)carbonyl]piperazin-1-yl}pyridin-3-amine | U-87201E | bis(heteroaryl)piperazine analog
TypeSmall organic molecule
Emp. Form.C21H25N5O2
Mol. Mass.379.4555
SMILESCCNc1cccnc1N1CCN(CC1)C(=O)c1cc2cc(OC)ccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: