new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCholecystokinin receptor
LigandBDBM50285011
Substrate/Competitorn/a
Meas. Tech.ChEBML_40187
IC50 0.260000±n/a nM
Citation Lowe JADrozda SEMcLean SBryce DKCrawford RTZorn SMorrone JAppleton TALombardo F A water soluble benzazepine cholecystokinin-B receptor antagonist Bioorg Med Chem Lett 5:1933-1936 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Cholecystokinin receptor
Name:Cholecystokinin receptor
Synonyms:CCK-2 receptor | CCK-B receptor | CCK-BR | CCKBR | Cholecystokinin A | Cholecystokinin-2 Receptor | Gastrin/cholecystokinin type B receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:48445.79
Organism:Homo sapiens (Human)
Description:Stable expression of human CCK-2 receptors in HEK 293 cells.
Residue:447
Sequence:
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285011
n/a
NameBDBM50285011
Synonyms:CHEMBL294252 | N-tert-Butyl-2-{(3R,5R)-5-cyclohexyl-3-[3-(3-methanesulfonylaminocarbonyl-phenyl)-ureido]-8-methyl-2-oxo-2,3,4,5-tetrahydro-benzo[b]azepin-1-yl}-acetamide
TypeSmall organic molecule
Emp. Form.C32H43N5O6S
Mol. Mass.625.779
SMILESCc1ccc2[C@H](C[C@@H](NC(=O)Nc3cccc(c3)C(=O)NS(C)(=O)=O)C(=O)N(CC(=O)NC(C)(C)C)c2c1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: