new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-specific 3',5'-cyclic phosphodiesterase 4B
LigandBDBM50285059
Substrate/Competitorn/a
Meas. Tech.ChEBML_155171
Ki 30±n/a nM
Citation Stafford JAValvano NLFeldman PLBrawley ESCowan DJDomanico PLLeesnitzer MARose DAStimpson SAStrickland ABUnwalla RJVerghese MW Phosphodiesterase type IV (PDE IV) inhibition. Synthesis and evaluation of a series of 1,3,4-trisubstituted pyrrolidines Bioorg Med Chem Lett 5:1977-1982 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Name:cAMP-specific 3',5'-cyclic phosphodiesterase 4B
Synonyms:DPDE4 | Isoform PDE4B1 | PDE32 | PDE4B1 | Phosphodiesterase 4B | Phosphodiesterase 4B (PDE4B) | Phosphodiesterase 4B (PDE4B1) | Phosphodiesterase Type 4 (PDE4B)
Type:Protein
Mol. Mass.:83318.87
Organism:Homo sapiens (Human)
Description:Q07343-1
Residue:736
Sequence:
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285059
n/a
NameBDBM50285059
Synonyms:1-(tert-butyl) 3-methyl 4-(3-cyclopentyloxy-4-methoxyphenyl)-(3S,4R)-tetrahydro-1H-1,3-pyrroledicarboxylate | CHEMBL292308
TypeSmall organic molecule
Emp. Form.C23H33NO6
Mol. Mass.419.5112
SMILESCOC(=O)[C@@H]1CN(C[C@H]1c1ccc(OC)c(OC2CCCC2)c1)C(=O)OC(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: