new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50285281
Substrate/Competitorn/a
Meas. Tech.ChEMBL_86286
Ki 1.2±n/a nM
Citation Desai RCDunlap RPFarrell RPFerguson EFranke CAGordon RHlasta DJTalomie TG Alkoxy substituted benzisothiazolone (BIT) derivatives: potent inhibitors of human leukocyte elastase Bioorg Med Chem Lett 5:105-109 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285281
n/a
NameBDBM50285281
Synonyms:2,6-Dichloro-benzoic acid 4,5-dimethoxy-1,1,3-trioxo-1,3-dihydro-1lambda*6*-benzo[d]isothiazol-2-ylmethyl ester | CHEMBL416154
TypeSmall organic molecule
Emp. Form.C17H13Cl2NO7S
Mol. Mass.446.259
SMILESCOc1ccc2c(C(=O)N(COC(=O)c3c(Cl)cccc3Cl)S2(=O)=O)c1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: