| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50285455 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79467 |
|---|
| IC50 | 0.100000±n/a nM |
|---|
| Citation |  Kim, BM; Guare, JP; Vacca, JD; Michelson, SR; Darke, PL; Zugay, JA; Emini, EA; Schleif, W; Lin, JH; Chen, IW; Vastag, K; Anderson, PS; Huff, JR Thiophene derivatives as extremely high affinity P3′ ligands for the hydroxyethylpiperazine class of HIV-1 protease inhibitors Bioorg Med Chem Lett5:185-190 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50285455 |
|---|
| n/a |
|---|
| Name | BDBM50285455 |
|---|
| Synonyms: | CHEMBL293992 | [(1S,2R)-3-((S)-4-Benzo[b]thiophen-2-ylmethyl-2-tert-butylcarbamoyl-piperazin-1-yl)-1-benzyl-2-hydroxy-propyl]-carbamic acid (2R,3R)-2-isopropyl-1,1-dioxo-tetrahydro-1lambda*6*-thiophen-3-yl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H50N4O6S2 |
|---|
| Mol. Mass. | 698.935 |
|---|
| SMILES | CC(C)[C@@H]1[C@@H](CCS1(=O)=O)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN1CCN(Cc2cc3ccccc3s2)C[C@H]1C(=O)NC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
