new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50285522
Substrate/Competitorn/a
Meas. Tech.ChEBML_1651
EC50 0.042000±n/a nM
Citation Macor JEBlank DHDesai KFox CBKoe BKLebel LAPost RJSchmidt AWSchulz DWSeymour PA 5-cyano-1-[3-(N-methylpyrrolidin-2R-ylmethyl)indol-5-yl] benzimidazole (CP-161,242): A potent, centrally active 5-HT1D receptor agonist and benzodiazepine partial agonist Bioorg Med Chem Lett 5:2391-2396 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:5-HT1D | 5-hydroxytryptamine receptor 1D | HTR1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41780.38
Organism:GUINEA PIG
Description:5-HT1D HTR1D GUINEA PIG::Q60484
Residue:376
Sequence:
MSPPNQSEEGLPQEASNRSLNATETPGDWDPGLLQALKVSLVVVLSIITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAGAMIAAVWVISICISIPPLFWRQAQ
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYSRIYRAARSRILNPPSLSGKRFT
TAHLITGSAGSSLCSLNPSLHEGHMHPGSPLFFNHVRIKLADSVLERKRISAARERKATK
TLGIILGAFIVCWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNE
DFRQAFQKVVHFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50285522
n/a
NameBDBM50285522
Synonyms:1-[3-((R)-1-Methyl-pyrrolidin-2-ylmethyl)-1H-indol-5-yl]-1H-benzoimidazole-5-carbonitrile | CHEMBL75642 | CP-161242
TypeSmall organic molecule
Emp. Form.C22H21N5
Mol. Mass.355.4356
SMILESCN1CCC[C@@H]1Cc1c[nH]c2ccc(cc12)-n1cnc2cc(ccc12)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: