Reaction Details |
| Report a problem with these data |
Target | Cysteinyl leukotriene receptor 1 |
---|
Ligand | BDBM50285674 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_99994 (CHEMBL710519) |
---|
IC50 | 0.76±n/a nM |
---|
Citation | Labelle, M; Gareau, Y; Dufresne, C; Lau, CK; Belley, M; Jones, TR; Leblanc, Y; McAuliffe, M; McFarlane, CS; Metters, KM; Ouimet, N; Perrier, H; Rochette, C; Sawyer, N; Slipetz, D; Xiang, YB; Wang, Z; Pickett, CB; Ford-Hutchinson, AW; Young, RN Discovery of L-740,515, a potent thienopyridine cysLT1 receptor (LTD4 receptor) antagonist Bioorg Med Chem Lett5:2551-2556 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cysteinyl leukotriene receptor 1 |
---|
Name: | Cysteinyl leukotriene receptor 1 |
Synonyms: | CLTR1_HUMAN | CYSLT1 | CYSLTR1 | Cysteinyl leukotriene D4 receptor | Cysteinyl leukotriene receptor | Cysteinyl leukotriene receptor 1 | HG55 | HMTMF81 | LTD4 receptor | Leukotriene Cysteinyl 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 38565.16 |
Organism: | Homo sapiens (Human) |
Description: | Leukotriene Cysteinyl 1 CYSLTR1 HUMAN::Q9Y271 |
Residue: | 337 |
Sequence: | MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
|
|
|
BDBM50285674 |
---|
n/a |
---|
Name | BDBM50285674 |
Synonyms: | (1-{(R)-1-{3-[(E)-2-(2,3-Difluoro-thieno[3,2-b]pyridin-5-yl)-vinyl]-phenyl}-3-[2-(1-hydroxy-1-methyl-ethyl)-phenyl]-propylsulfanylmethyl}-cyclopropyl)-acetic acid | CHEMBL314237 |
Type | Small organic molecule |
Emp. Form. | C33H33F2NO3S2 |
Mol. Mass. | 593.747 |
SMILES | CC(C)(O)c1ccccc1CC[C@@H](SCC1(CC(O)=O)CC1)c1cccc(\C=C\c2ccc3sc(F)c(F)c3n2)c1 |
Structure |
|