| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50285699 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_79978 (CHEMBL874137) |
|---|
| Ki | 12±n/a nM |
|---|
| Citation |  Randad, RS; Lubkowska, L; Bujacz, A; Naik, RH; Gulnik, SV; Yu, B; Silva, A; Munshi, S; Lynch, TM; Clanton, DJ; Bhat, TN; Erickson, JW Structure-based design of achiral anthranilamides as P2/P2′ surrogates for symmetry-based HIV protease inhibitors: design, synthesis, X-ray structure, enzyme inhibition and antiviral activity Bioorg Med Chem Lett5:2557-2562 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50285699 |
|---|
| n/a |
|---|
| Name | BDBM50285699 |
|---|
| Synonyms: | Anthranilamide derivative | CHEMBL87879 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C50H50N4O8 |
|---|
| Mol. Mass. | 834.954 |
|---|
| SMILES | Cc1cccc(C(=O)N[C@@H](Cc2ccccc2)[C@H](O)[C@H](O)[C@H](Cc2ccccc2)NC(=O)c2cccc(C)c2NC(=O)OCc2ccccc2)c1NC(=O)OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
