| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50285964 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79955 |
|---|
| IC50 | 0.500000±n/a nM |
|---|
| Citation |  Munroe, JE; Hornback, WJ; Campbell, JB; Ouellette, MA; Hatch, SD; Muesing, MA; Wiskerchen, MA; Baxter, AJ; Su, K; Campanale, K Ly316340: A potent HIV-1 protease inhibitor containing a high affinity octahydrothienopyridine hydroxyethylamine isostere Bioorg Med Chem Lett5:2885-2890 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50285964 |
|---|
| n/a |
|---|
| Name | BDBM50285964 |
|---|
| Synonyms: | (3aR,6S,7aS)-5-[(2R,3S)-2-Hydroxy-3-(3-hydroxy-2-methyl-benzoylamino)-4-phenyl-butyl]-octahydro-thieno[3,2-c]pyridine-6-carboxylic acid tert-butylamide | CHEMBL98096 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H41N3O4S |
|---|
| Mol. Mass. | 539.729 |
|---|
| SMILES | Cc1c(O)cccc1C(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN1C[C@H]2CCS[C@H]2C[C@H]1C(=O)NC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
