new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSubstance-P receptor
LigandBDBM50000041
Substrate/Competitorn/a
Meas. Tech.ChEBML_142888
IC50 0.600000±n/a nM
Citation Harrison TOwens APWilliams BJSwain CJBaker RHutson PHSadowski SCascieri MA Piperidine-ether based hNK1 antagonists 2: Investigation of the effect of N-substitution Bioorg Med Chem Lett 5:209-212 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Substance-P receptor
Name:Neurokinin 1 receptor
Synonyms:NK-1 receptor | NK-1R | NK1 Receptor | Neurokinin 1 receptor | Neurokinin-1 (NK-1) | Neuromedin-1 receptor (NK-1R) | SPR | Tachykinin receptor 1 | Tachykinin receptor 1 (NK1) | tachykinin
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46254.43
Organism:Homo sapiens (Human)
Description:P25103
Residue:407
Sequence:
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000041
n/a
NameBDBM50000041
Synonyms:(+) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (+/-)(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-) (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (-)-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-((1R,4S)-2-phenyl-piperidin-4-yl)-amine | (2-Methoxy-benzyl)-((2S,3S)-2-phenyl-piperidin-3-yl)-amine | (2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine | (2S,3S)-3-(2-Methoxy-benzyloxy)-2-phenyl-piperidine | (2S,3S)-N-(2-methoxybenzyl)-2-phenylpiperidin-3-amine | CHEMBL2114310 | CHEMBL441225 | CP 99994 | CP-99994 | Tritiated-(2-Methoxy-benzyl)-(2-phenyl-piperidin-3-yl)-amine
TypeSmall organic molecule
Emp. Form.C19H24N2O
Mol. Mass.296.4067
SMILESCOc1ccccc1CN[C@H]1CCCN[C@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: