| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cysteinyl leukotriene receptor 1 |
|---|
| Ligand | BDBM50052019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_99860 |
|---|
| IC50 | 1.5±n/a nM |
|---|
| Citation |  Labelle, M; Belley, M; Gareau, Y; Gauthier, JY; Guay, D; Gordon, R; Grossman, SG; Jones, TR; Leblanc, Y; McAuliffe, M; McFarlane, C; Masson, P; Metters, KM; Ouimet, N; Patrick, DH; Piechuta, H; Rochette, C; Sawyer, N; Xiang, YB; Pickett, CB Discovery of MK-0476, a potent and orally active leukotriene D4 receptor antagonist devoid of peroxisomal enxyme induction Bioorg Med Chem Lett5:283-288 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cysteinyl leukotriene receptor 1 |
|---|
| Name: | Cysteinyl leukotriene receptor 1 |
|---|
| Synonyms: | CLTR1_CAVPO | CYSLTR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39007.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | Leukotriene D4 0 GUINEA PIG::Q2NNR5 |
|---|
| Residue: | 340 |
|---|
| Sequence: | MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSA
FQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAM
SFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPP
QDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIV
VTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFF
SGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
|
|
|
|---|
| BDBM50052019 |
|---|
| n/a |
|---|
| Name | BDBM50052019 |
|---|
| Synonyms: | CHEMBL89768 | L-660771 | MK-571 | Sodium; 3-[{3-[(E)-2-(7-chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionate | Sodium;3-[{3-[(E)-2-(7-chloro-quinolin-2-yl)-vinyl]-phenyl}-(2-dimethylcarbamoyl-ethylsulfanyl)-methylsulfanyl]-propionate | sodium (E)-3-((3-(2-(7-chloroquinolin-2-yl)vinyl)phenyl)(3-(dimethylamino)-3-oxopropylthio)methylthio)propanoate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H26ClN2O3S2 |
|---|
| Mol. Mass. | 514.08 |
|---|
| SMILES | CN(C)C(=O)CCSC(SCCC([O-])=O)c1cccc(\C=C\c2ccc3ccc(Cl)cc3n2)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
