new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain1/2
LigandBDBM50286434
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43649
IC50 600±n/a nM
Citation Graybill TLDolle REOsifo IKSchmidt SJGregory JSHarris ALMiller MS Inhibition of human erythrocyte calpain I by novel quinolinecarboxamides Bioorg Med Chem Lett 5:387-392 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Calpain1/2
Name:Calpain1/2
Synonyms:Calpain -type | Calpain-1 (u-Calpain) | Calpain-1 catalytic subunit
Type:Protein
Mol. Mass.:81880.51
Organism:Homo sapiens (Human)
Description:n/a
Residue:714
Sequence:
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286434
n/a
NameBDBM50286434
Synonyms:1-(2-Chloro-4-hydroxy-phenyl)-4-oxo-7-pyridin-4-yl-1,4-dihydro-quinoline-3-carboxylic acid amide | CHEMBL340384
TypeSmall organic molecule
Emp. Form.C21H14ClN3O3
Mol. Mass.391.807
SMILESNC(=O)c1cn(-c2ccc(O)cc2Cl)c2cc(ccc2c1=O)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: