new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1d (5-HT1d) receptor
LigandBDBM50286672
Substrate/Competitorn/a
Meas. Tech.ChEBML_1659
IC50 60±n/a nM
Citation Perez MPauwels PPalmier CJohn GWValentin JPHalazy S 5-O-Carboxymethyl piperazide derivatives of serotonin: a new class of potent and selective 5-HT1D receptor agonists Bioorg Med Chem Lett 5:663-666 (1995)    Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1d (5-HT1d) receptor
Name:Serotonin 1d (5-HT1d) receptor
Synonyms:5-HT1D | 5-hydroxytryptamine receptor 1D | HTR1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41780.38
Organism:GUINEA PIG
Description:5-HT1D HTR1D GUINEA PIG::Q60484
Residue:376
Sequence:
MSPPNQSEEGLPQEASNRSLNATETPGDWDPGLLQALKVSLVVVLSIITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAGAMIAAVWVISICISIPPLFWRQAQ
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYSRIYRAARSRILNPPSLSGKRFT
TAHLITGSAGSSLCSLNPSLHEGHMHPGSPLFFNHVRIKLADSVLERKRISAARERKATK
TLGIILGAFIVCWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFNE
DFRQAFQKVVHFRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50286672
n/a
NameBDBM50286672
Synonyms:(S)-2-(2-{2-[3-(2-Amino-ethyl)-1H-indol-5-yloxy]-acetylamino}-acetylamino)-3-(4-hydroxy-phenyl)-propionamide | CHEMBL159174 | GTI
TypeSmall organic molecule
Emp. Form.C23H27N5O5
Mol. Mass.453.491
SMILESNCCc1c[nH]c2ccc(OCC(=O)NCC(=O)N[C@@H](Cc3ccc(O)cc3)C(N)=O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: