| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50213826 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159623 (CHEMBL881019) |
|---|
| IC50 | <0.250000±n/a nM |
|---|
| Citation |  Kaldor, SW; Appelt, K; Fritz, JE; Hammond, M; Crowell, TA; Baxter, AJ; Hatch, SD; Wiskerchen, M; Muesing, MA A systematic study of P1–P3 spanning sidechains for the inhibition of HIV-1 protease Bioorg Med Chem Lett5:715-720 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50213826 |
|---|
| n/a |
|---|
| Name | BDBM50213826 |
|---|
| Synonyms: | CHEMBL164045 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C39H41N5O5S |
|---|
| Mol. Mass. | 691.838 |
|---|
| SMILES | CC(C)(C)NC(=O)c1ccccc1C[C@@H](O)[C@H](CSc1ccc2ccccc2c1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
