| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50061307 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157737 |
|---|
| Ki | 3±n/a nM |
|---|
| Citation |  Kalish, VJ; Tatlock, JH; Davies, JF; Kaldor, SW; Dressman, BA; Reich, S; Pino, M; Nyugen, D; Appelt, K; Musick, L; Wu, Bw Structure-based drug design of nonpeptidic P2 substituents for HIV-1 protease inhibitors Bioorg Med Chem Lett5:727-732 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50061307 |
|---|
| n/a |
|---|
| Name | BDBM50061307 |
|---|
| Synonyms: | AG-1254 | CHEMBL128696 | N-[(1R,2R)-3-(2-tert-Butylcarbamoyl-phenyl)-2-hydroxy-1-(naphthalen-2-ylsulfanylmethyl)-propyl]-3-hydroxy-2-methyl-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H36N2O4S |
|---|
| Mol. Mass. | 556.715 |
|---|
| SMILES | Cc1c(O)cccc1C(=O)N[C@@H](CSc1ccc2ccccc2c1)[C@H](O)Cc1ccccc1C(=O)NC(C)(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
