Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50286707 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157737 |
---|
Ki | 800±n/a nM |
---|
Citation | Kalish, VJ; Tatlock, JH; Davies, JF; Kaldor, SW; Dressman, BA; Reich, S; Pino, M; Nyugen, D; Appelt, K; Musick, L; Wu, Bw Structure-based drug design of nonpeptidic P2 substituents for HIV-1 protease inhibitors Bioorg Med Chem Lett5:727-732 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50286707 |
---|
n/a |
---|
Name | BDBM50286707 |
Synonyms: | CHEMBL445642 | Isoquinoline-5-carboxylic acid [(1R,2R)-3-(2-tert-butylcarbamoyl-phenyl)-2-hydroxy-1-(naphthalen-2-ylsulfanylmethyl)-propyl]-amide |
Type | Small organic molecule |
Emp. Form. | C35H35N3O3S |
Mol. Mass. | 577.736 |
SMILES | CC(C)(C)NC(=O)c1ccccc1C[C@@H](O)[C@H](CSc1ccc2ccccc2c1)NC(=O)c1cccc2cnccc12 |
Structure |
|