new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenergic alpha1B
LigandBDBM50287721
Substrate/Competitorn/a
Meas. Tech.ChEBML_33015
Ki 1150±n/a nM
Citation Phife DWRamos RAFeng MKing IGunasekera SPWright APatel MPachter JACoval SJ Marine sponge bis(indole) alkaloids that displace ligand binding to α1 adrenergic receptors Bioorg Med Chem Lett 6:2103-2106 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Adrenergic alpha1B
Name:Adrenergic receptor alpha
Synonyms:Alpha 1B-adrenoceptor | Alpha 1B-adrenoreceptor | Alpha-1B adrenergic receptor
Type:Enzyme
Mol. Mass.:56862.13
Organism:Homo sapiens (Human)
Description:P35368
Residue:520
Sequence:
MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV
RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT
LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT
EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50287721
n/a
NameBDBM50287721
Synonyms:(6-Hydroxy-1H-indol-3-yl)-[5-(1H-indol-3-yl)-1H-imidazol-2-yl]-methanone | CHEMBL303282 | TOPSENTIN | topsentin B1
TypeSmall organic molecule
Emp. Form.C20H14N4O2
Mol. Mass.342.3508
SMILESOc1ccc2c(c[nH]c2c1)C(=O)c1nc(c[nH]1)-c1c[nH]c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: