| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50287808 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_46993 |
|---|
| Ki | 397±n/a nM |
|---|
| Citation |  Gallant, M; Dufresne, C; Gareau, Y; Guay, D; Leblanc, Y; Prasit, P; Rochette, C; Sawyer, N; Slipetz, DM; Tremblay, N; Metters, KM; Labelle, M New class of potent ligands for the human peripheral cannabinoid receptor Bioorg Med Chem Lett6:2263-2268 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50287808 |
|---|
| n/a |
|---|
| Name | BDBM50287808 |
|---|
| Synonyms: | CHEMBL307210 | [1-(2-Chloro-benzoyl)-5-methoxy-2-methyl-1H-indol-3-yl]-acetic acid methyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18ClNO4 |
|---|
| Mol. Mass. | 371.814 |
|---|
| SMILES | COC(=O)Cc1c(C)n(C(=O)c2ccccc2Cl)c2ccc(OC)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
