new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50287935
Substrate/Competitorn/a
Meas. Tech.ChEBML_46992
Ki 2±n/a nM
Citation Gareau YDufresne CGallant MRochette CSawyer NSlipetz DMTremblay NWeech PKMetters KMLabelle M Structure activity relationships of tetrahydrocannabinol analogues on human cannabinoid receptors Bioorg Med Chem Lett 6:189-194 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50287935
n/a
NameBDBM50287935
Synonyms:4-(1,1-Dimethyl-heptyl)-3',5'-dimethyl-biphenyl-2,6-diol | CHEMBL56288
TypeSmall organic molecule
Emp. Form.C23H32O2
Mol. Mass.340.499
SMILESCCCCCCC(C)(C)c1cc(O)c(c(O)c1)-c1cc(C)cc(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: