Reaction Details |
| Report a problem with these data |
Target | Chymotrypsin-like elastase family member 2A |
---|
Ligand | BDBM50282866 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_158078 |
---|
Ki | 20±n/a nM |
---|
KON | 1300 M-1s-1 |
---|
Citation | Hlasta, DJ; Court, JJ; Desai, RC; Talomie, TG; Shen, J; Dunlap, RP; and, CA; Mura, AJ A comparative SAR and computer modeling study of benzisothiazolone, mechanism-based inhibitors with porcine pancreatic and human leukocyte elastase Bioorg Med Chem Lett6:2941-2946 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsin-like elastase family member 2A |
---|
Name: | Chymotrypsin-like elastase family member 2A |
Synonyms: | CEL2A_PIG | CELA2A | ELA2 | ELA2A | Elastase 2A | Elastase-2 | Elastase-2A | Pancreatic elastase |
Type: | PROTEIN |
Mol. Mass.: | 28705.23 |
Organism: | Sus scrofa |
Description: | ChEMBL_156951 |
Residue: | 269 |
Sequence: | MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
|
|
|
BDBM50282866 |
---|
n/a |
---|
Name | BDBM50282866 |
Synonyms: | 4-Ethyl-1,1-dioxo-2-(1-phenyl-1H-tetrazol-5-ylsulfanylmethyl)-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL296159 |
Type | Small organic molecule |
Emp. Form. | C17H15N5O3S2 |
Mol. Mass. | 401.463 |
SMILES | CCc1cccc2c1C(=O)N(CSc1nnnn1-c1ccccc1)S2(=O)=O |
Structure |
|