| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsin-like elastase family member 2A |
|---|
| Ligand | BDBM50282866 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158223 (CHEMBL764240) |
|---|
| KON | 1300 M-1s-1 |
|---|
| Citation |  Hlasta, DJ; Court, JJ; Desai, RC; Talomie, TG; Shen, J; Dunlap, RP; and, CA; Mura, AJ A comparative SAR and computer modeling study of benzisothiazolone, mechanism-based inhibitors with porcine pancreatic and human leukocyte elastase Bioorg Med Chem Lett6:2941-2946 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsin-like elastase family member 2A |
|---|
| Name: | Chymotrypsin-like elastase family member 2A |
|---|
| Synonyms: | CEL2A_PIG | CELA2A | ELA2 | ELA2A | Elastase 2A | Elastase-2 | Elastase-2A | Pancreatic elastase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28705.23 |
|---|
| Organism: | Sus scrofa |
|---|
| Description: | ChEMBL_156951 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MIRALLLSTLVAGALSCGLPANLPQLPRVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGG
TLVDQSWVLTAAHCISSSRTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGN
DIALLKLASPVSLTDKIQLGCLPAAGTILPNNYVCYVTGWGRLQTNGASPDILQQGQLLV
VDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNCQGANGQWQVHGIVSFGSS
LGCNYYHKPSVFTRVSNYIDWINSVIANN
|
|
|
|---|
| BDBM50282866 |
|---|
| n/a |
|---|
| Name | BDBM50282866 |
|---|
| Synonyms: | 4-Ethyl-1,1-dioxo-2-(1-phenyl-1H-tetrazol-5-ylsulfanylmethyl)-1,2-dihydro-1lambda*6*-benzo[d]isothiazol-3-one | CHEMBL296159 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15N5O3S2 |
|---|
| Mol. Mass. | 401.463 |
|---|
| SMILES | CCc1cccc2c1C(=O)N(CSc1nnnn1-c1ccccc1)S2(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
