Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Ligand | BDBM50072190 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_202904 |
---|
Ki | 920±n/a nM |
---|
Citation | Abell, AD; Brandt, M; Levy, MA; Holt, DA A comparison of steroidal and non-steroidal inhibitors of human steroid 5α-reductase: New tricyclic aryl acid inhibitors of the type-1 isozyme Bioorg Med Chem Lett6:481-484 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
Type: | Enzyme |
Mol. Mass.: | 29472.80 |
Organism: | Homo sapiens (Human) |
Description: | P18405 |
Residue: | 259 |
Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
BDBM50072190 |
---|
n/a |
---|
Name | BDBM50072190 |
Synonyms: | (R)-8-Chloro-4,10b-dimethyl-1,5,6,10b-tetrahydro-2H-phenanthridin-3-one | CHEMBL97266 |
Type | Small organic molecule |
Emp. Form. | C15H16ClNO |
Mol. Mass. | 261.747 |
SMILES | CC1C(=O)CC[C@@]2(C)C1=NCc1cc(Cl)ccc21 |t:9| |
Structure |
|