new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5α-Reductase 1 (5α-R1)
LigandBDBM50044879
Substrate/Competitorn/a
Meas. Tech.ChEBML_202904
Ki 10±n/a nM
Citation Abell ADBrandt MLevy MAHolt DA A comparison of steroidal and non-steroidal inhibitors of human steroid 5α-reductase: New tricyclic aryl acid inhibitors of the type-1 isozyme Bioorg Med Chem Lett 6:481-484 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
5α-Reductase 1 (5α-R1)
Name:Steroid 5-alpha-reductase
Synonyms:3-oxo-5-alpha-steroid 4-dehydrogenase 1 | S5AR | SR type 1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1
Type:Enzyme
Mol. Mass.:29472.80
Organism:Homo sapiens (Human)
Description:P18405
Residue:259
Sequence:
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50044879
n/a
NameBDBM50044879
Synonyms:(4aR,10bR)-8-Chloro-4,10b-dimethyl-1,4,4a,5,6,10b-hexahydro-2H-benzo[f]quinolin-3-one | 8-Chloro-4,10b-dimethyl-1,4,4a,5,6,10b-hexahydro-2H-benzo[f]quinolin-3-one | CHEMBL29166 | LY-266111
TypeSmall organic molecule
Emp. Form.C15H18ClNO
Mol. Mass.263.763
SMILESCN1[C@@H]2CCc3cc(Cl)ccc3[C@@]2(C)CCC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: