Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Ligand | BDBM50403608 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_202913 |
---|
Ki | 1600±n/a nM |
---|
Citation | Abell, AD; Brandt, M; Levy, MA; Holt, DA A comparison of steroidal and non-steroidal inhibitors of human steroid 5α-reductase: New tricyclic aryl acid inhibitors of the type-1 isozyme Bioorg Med Chem Lett6:481-484 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
Type: | Enzyme |
Mol. Mass.: | 28406.59 |
Organism: | Homo sapiens (Human) |
Description: | P31213 |
Residue: | 254 |
Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
BDBM50403608 |
---|
n/a |
---|
Name | BDBM50403608 |
Synonyms: | CHEMBL439804 |
Type | Small organic molecule |
Emp. Form. | C15H16ClO2P |
Mol. Mass. | 294.713 |
SMILES | C[C@]12CCC(CC1=CCc1cc(Cl)ccc21)P(=O)=O |c:7| |
Structure |
|