| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50288942 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_160741 |
|---|
| Ki | 0.162000±n/a nM |
|---|
| Citation |  Park, C; Choi, H; Son, YC; Lee, CS; Choy, N; Koh, JS; Lee, TG; Kwon, YD; Kim, SC; Yoon, H β-Methanesulfonyl-L-valine as a novel, unnatural amino acid surrogate for P2 in the design of HIV protease inhibitors. Bioorg Med Chem Lett6:585-588 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50288942 |
|---|
| n/a |
|---|
| Name | BDBM50288942 |
|---|
| Synonyms: | CHEMBL154692 | {(R)-1-[(1S,2R)-1-Benzyl-3-((3S,4aS,8aS)-3-tert-butylcarbamoyl-octahydro-isoquinolin-2-yl)-2-hydroxy-propylcarbamoyl]-2-methanesulfonyl-2-methyl-propyl}-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H56N4O7S |
|---|
| Mol. Mass. | 712.939 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1C[C@@H]2CCCC[C@@H]2CN1C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)OCc1ccccc1)C(C)(C)S(C)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
