new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50288945
Substrate/Competitorn/a
Meas. Tech.ChEBML_157722
Ki 1320±n/a nM
Citation Lee CSChoy NPark CChoi HSon YCKim SOk JHYoon HKim SC Design, synthesis, and characterization of dipeptide isostere containing cis-epoxide for the irreversible inactivation of HIV protease Bioorg Med Chem Lett 6:589-594 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50288945
n/a
NameBDBM50288945
Synonyms:2-{2-[(2R,3S)-3-((S)-1-Benzyloxycarbonylamino-2-phenyl-ethyl)-oxiranyl]-acetylamino}-3-methyl-butyric acid | CHEMBL155384
TypeSmall organic molecule
Emp. Form.C25H30N2O6
Mol. Mass.454.5155
SMILESCC(C)C(NC(=O)C[C@H]1O[C@H]1[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: