| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50288948 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157722 |
|---|
| Ki | 200000±n/a nM |
|---|
| Citation |  Lee, CS; Choy, N; Park, C; Choi, H; Son, YC; Kim, S; Ok, JH; Yoon, H; Kim, SC Design, synthesis, and characterization of dipeptide isostere containing cis-epoxide for the irreversible inactivation of HIV protease Bioorg Med Chem Lett6:589-594 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50288948 |
|---|
| n/a |
|---|
| Name | BDBM50288948 |
|---|
| Synonyms: | 2-{2-[(2R,3R)-3-((S)-1-Benzyloxycarbonylamino-2-phenyl-ethyl)-oxiranyl]-acetylamino}-3-methyl-butyric acid | CHEMBL155895 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N2O6 |
|---|
| Mol. Mass. | 454.5155 |
|---|
| SMILES | CC(C)C(NC(=O)C[C@H]1O[C@@H]1[C@H](Cc1ccccc1)NC(=O)OCc1ccccc1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
