new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement C1s
LigandBDBM50063698
Substrate/Competitorn/a
Meas. Tech.ChEBML_40178
IC50 140±n/a nM
Citation Gilmore JLHays SJCaprathe BWLee CEmmerling MRMichael WJaen JC Synthesis and evaluation of 2-aryl-4H-3,1-benzoxazin-4-ones as C1r serine protease inhibitors Bioorg Med Chem Lett 6:679-682 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Complement C1s
Name:Complement C1s
Synonyms:C1 esterase | Complement C1s subcomponent | Complement C1s subcomponent heavy chain | Complement C1s subcomponent light chain | Complement component 1 subcomponent s | Trypsin | complement component 1, s subcomponent
Type:Protein
Mol. Mass.:76657.91
Organism:Homo sapiens (Human)
Description:P09871
Residue:688
Sequence:
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50063698
n/a
NameBDBM50063698
Synonyms:4-Guanidino-benzoic acid 6-carbamimidoyl-naphthalen-2-yl ester | 4-Guanidino-benzoic acid 6-carbamimidoyl-naphthalen-2-yl ester(FUT-175) | CHEMBL273264
TypeSmall organic molecule
Emp. Form.C19H17N5O2
Mol. Mass.347.3706
SMILES[#7]\[#6](-[#7])=[#7]/c1ccc(cc1)-[#6](=O)-[#8]-c1ccc2cc(ccc2c1)-[#6](-[#7])=[#7]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: