| Reaction Details |
|---|
 | Report a problem with these data |
| Target | MHC class II antigen |
|---|
| Ligand | BDBM50289265 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_192856 (CHEMBL799390) |
|---|
| IC50 | 320±n/a nM |
|---|
| Citation |  Cunningham, BR; Rivetna, M; Tolman, RL; Flattery, SJ; Nichols, EA; Schwartz, CD; Wicker, LS; Hermes, JD; Jones, AB SAR for MHC class II binding tetrapeptides: Correlation with potential binding site Bioorg Med Chem Lett7:19-24 (1997) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| MHC class II antigen |
|---|
| Name: | MHC class II antigen |
|---|
| Synonyms: | DR-1 | DR1 | HLA class II histocompatibility antigen DRB1-1 | HLA class II histocompatibility antigen, DRB1-1 beta chain | Human leukocyte antigen DR beta chain | MHC class I antigen DRB1*1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29917.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_192854 |
|---|
| Residue: | 266 |
|---|
| Sequence: | MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCI
YNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTV
QRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLL
FLGAGLFIYFRNQKGHSGLQPTGFLS
|
|
|
|---|
| BDBM50289265 |
|---|
| n/a |
|---|
| Name | BDBM50289265 |
|---|
| Synonyms: | (S)-2-[(S)-3-Carbamoyl-2-((S)-2-{[(R)-2-ethoxycarbonylamino-3-(1H-indol-3-yl)-propionyl]-methyl-amino}-5-guanidino-pentanoylamino)-propionylamino]-3-methyl-butyric acid | CHEMBL312367 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H45N9O8 |
|---|
| Mol. Mass. | 659.7338 |
|---|
| SMILES | CCOC(=O)N[C@H](Cc1c[nH]c2ccccc12)C(=O)N(C)[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
